ShopDreamUp AI ArtDreamUp
KarolHofman has limited the viewing of this artwork to members of the DeviantArt community only.
You can log in or become a member for FREE.
Deviation Actions
Suggested Deviants
Suggested Collections
You Might Like…
Featured in Groups
5thattackbasicfanfanmadefighterhealerhenshinhofmanimaginaryinnersitemkakyuukarolkookoulightlightsmakemakermakeupmoonnormalpenpowerprincessregularsailorsailormoonseasonseiyasenshistarstarfighterstarhealerstarlightstarlightsstarmakerstarpowerstarsstickstyletaikiteamtransformationupwandyatenprzemianaprincessstarkarolhofmansailormoonsenshiattackstarmade
Description
Maker Star Power, Make Up!
=================================
READ ME!!!
Do NOT copy, trace, edit or repost this artwork. I put a lot of effort into this picture and I don't want you to reuse elements of it, not to mention editing whole picture. Please, respect my will. I count on your fairness. Thanks!
=================================
EXPLANATION:
This is the Maker Star Power Stick transformation item (henshin wand) for Sailor Star Maker, or more precisely - Taiki Kou to become Star Sailor Senshi of the fifth season of the anime (Sailor Moon Sailor Stars) in the style of Inner Senshi from the second season of the 90s anime - Sailor Moon R. This is a what-if idea and fanmade item.
This is a what-if idea. THIS ITEM IS NOT THE OFFICIAL ITEM!!! NOR IS THE DESIGN!!! I have searched through dA and Google and I haven't found Star Power Sticks done for Star Lights. So I decided to make ones for them. But let's be honest here. Isn't it obvious that if Inner Senshi use "Star Power, Make Up!" incantation just like Star Lights, shouldn't Star Lights also have fan-created Star Power Sticks for them? LOL And here I am with my own idea Haha I hope you will enjoy it as much as I enjoyed making this item ^^
Some years ago I made Star Power Brooches and Sailor Star Yells for Solar System Senshi - a Star Light style items. And I immediately thought about making Star Power Sticks for Star Lights. The idea originated back in February 2013 and it was started back then. But I never got a push to actually make it come real. Now I had the inspiration to finally make it! And I want to continue ^^ So the future plans for Star Power Sticks of Star Lights are: making 2nd and 3rd version of Star Power Sticks for Star Lights in the unison form (similar for everyone; I have some nice ideas for them), making Sailor Kakyuu's version and 4 individual Star Power Sticks for each of Star Lights (Fighter, Healer, Maker and my OC - Lover). Please, stay tuned for them ^^
-----------------------------------------------------
Now it is time for Sailor Star Maker! Third individual Star Light style Star Power Stick! Yay! As you can see I have changed some colors here and there as compared to the version identical for everyone. The so called - Original Star Power Stick for Star Lights. Back in 2011 when I did Sailor Star Brooches for Star Lights in individual colors, I decided to give Star Lights 1st and 2nd colors.
For Star Maker I decided to use purple, because that's the color of her accessories in the 90s anime. I think this decision was quite obvious. It was not as problematic as main color for Star Fighter. What is more, purple for Star Maker appears as her as aura color during her attacks and in the background of second of her transformation (as well as the color of the galaxy in the final pose backgrounds). But blue seems to be more associated to her (like the BG in the 2nd version of her transformation). Which is quite odd as accessories for Fighter are in blue. As for the secondary color of Star Maker I decided to use creme yellow as this color is the color of Taiki's stage suit (quite problematic because details of the wand itself are golden, but I managed to keep the balance. At least I believe I did ) All in all, I like it ^^
For other Sailor Items please visit my gallery ^^
=================================
SOME INFO NOW ON THE ORIGINAL STAR LIGHTS' HENSHIN ITEMS:
In both manga and anime Star Lights transformed with two-pieced henshin item: Sailor Change Star - the head-set with microphone and Sailor Star Brooch - the winged chest brooch. They both formed Sailor Star Set. In order to transform Sailor Star Lights used their Brooches. In both versions they held it up and shouted their phrases.
In the anime, the transformation sequence also portrayed Change Star (an ear-wore microphone that appeared just when they phrase was being shouted). During the henshin Star Brooch was visible on the Senshi's chest and flashed during it. Star Brooch was likely the true transformation item of the Sailor Starlight's. The design of the Star Brooch and Change Star was similar for each of the Star Lights, but I did separate color versions of the Star Brooches for them. See links below for that ^^
=================================
SOME INFO NOW ON THE STAR POWER STICKS HENSHIN ITEMS:
In both manga and anime Star Power Sticks served as 2nd transformation items for Inner Senshi. They were given to them by Luna, replacing much weaker Transformation Pens. Star Power Sticks were the longest active transformation items in the Sailor Moon anime as they were used in most of Sailor Moon R, whole Sailor Moon S and half of Sailor Moon SuperS.
The Star Power Sticks were later replaced by (or more accurate - updated to) Crystal Change Rods by super powers of Pegasus in the 4th season of the anime. In the manga the final fate of Star Power Sticks is unknown as at the end of Black Moon Arc Neo-Queen Serenity gave Inner Senshi new powers - Planet Powers. And from that time on they were never shown again as Inner Senshi only needed to held up their hands in order to transform by invoking Planet Powers of their respective celestial bodies.
=================================
SEE ALSO:
<Name> Star Power, Make Up! - My Interpretation of Sailor Star Lights' Star Power Stick Henshin Item
The picture linked here is meant to show Star Power Stick for Star Lights in Original, identical form for each of them!
-----------------------------------------------------
Kinmoku Sailor Senshi Items - a folder in my gallery with items done for Kinmoku Sailor Senshi (Star Lights and Princess Kakyuu) as well as Star Light Style Items for Solar System Sailor Senshi. Please, visit and enjoy the pictures :-*
-----------------------------------------------------
<Name> Star Power, Make Up! - My Interpretation of Sailor Star Lights' Star Brooch Henshin Item
-----------------------------------------------------
ORIGINAL STAR LIGHTS' HENSHIN PHRASES (BROOCH FORMS):
Fighter Star Power, Make Up! - Sailor Star Fighter's Original Transformation Phrase (See Individual Color Version: fav.me/d39qqzu )
Healer Star Power, Make Up! - Sailor Star Healer's Original Transformation Phrase (See Individual Color Version: fav.me/d39qrfc )
Maker Star Power, Make Up! - Sailor Star Maker's Original Transformation Phrase (See Individual Color Version: fav.me/d39qrnf )
-----------------------------------------------------
ATTACK ITEM OF STAR LIGHTS:
Star <Adjective> <Noun>! - a Sailor Star Lights' attack with Sailor Star Yell from the 5th season of the Anime
=================================
DETAILS:
Before getting into details please notice that to make this wand I used lineart of "Mercury Star Power, Make Up!" and new shading effects from "Star Power of Ami and Friends", slightly modifying them to suit my taste and vision. I'm really sorry if that makes you upset, but that way I could make it easier. Beside, the first version of lineart was quite good. I had only few issues with shading. So that needed to be updated. The whole idea of this version of Star Power Stick was to make it similar to the ones owned by Inner Senshi, but distinguish different.
In order to better understand what I'm talking about, please visit this deviation here: karolhofman.deviantart.com/art… It shows the first version of Star Light style Star Power Stick identical for everyone.
-----------------------------------------------------
OK. Let's start with pointing out all the differences. From top to bottom. The top star has extra shading added now to make it look more 3d and more in the style of my recent works Continuing. The middle of the top star on Inner Senshi's Star Power Sticks is a circular plate which showcases planetary symbol for each of them. Since Star Lights don't have planetary symbols I decided to put there some kind of crystal. Firstly, I wanted it to be star-shaped, but then I scrapped that idea as there would be too many stars. So I placed there circular crystal from Sailor Star Yell - attack item of Star Lights. Originally it is orange, but for Star Maker's version I colored it in purple - Maker's main color.
The four pearls around said crystal have now circular rims (because when you zoom in, for example, Mercury's Star Power Stick, you will notice them). They are colored in the same color as on the original Star Power Sticks. But the pearls themselves for "Original" Star Lights' Star Power Sticks were colored in yellow/golden. For Star Maker they are in creme yellow - the secondary color for Star Maker (reminder: originally they are golden). I know that the original color and Maker's creme yellow are too similar, but I guess it still looks quite nice, eh? Moving down, the crown-like thing under star was colored in creme yellow as well (originally light blue).
On both sides of the crown-like thing, there are wings. They are the same as ones from Sailor Star Yell, but modified slightly to fit with the overall design of the stick. I had to add somewhere wings, and this was the best place to do so. All the items of Star Lights from anime and manga have wings: Star Power Brooch, Star Power Headset and Sailor Star Yell. So their versions of Star Power Sticks also need to include them. OK. Moving down on the stick, we have the handle of the wand. It was colored in Maker's purple. Originally it is navy blue - the same color as Sailor Star Lights' leather outfits. I like in the end how it turned out ^^
Bottom part was colored in orange-like golden (the same color as the main part of the crown-like thingy) and creme yellow (originally sand-like golden - the same color as the top star). The last touch was adding a chain to the wand. I felt like something is lacking here. And I remembered that Star Power Brooch of Star Lights has a chain, so I added it here too. Two stripes of them. But again, something was lacking so I added star-like charms at the end. And that was my final touch to this Star Power Stick. I think that all these changes make it similar to the Inner Senshi's ones, but still having the spirit of Star Lights in it. I love how it turned out! Yay!
And that's probably all I had to say here ^^
=================================
IMPORTANT VIDEO TO BE SEEN!!! xD
Star Lights Transformation Theme - Please listen to this Transformation Theme of Star Lights to better understand the meaning of this picture and feel the power of Three Lights!!!
=================================
FUN FACTS - TRIIVIA:
Did you know that Star Lights had 2 versions of their transformations? Most of Sailor Moon Sailor Stars season had their transformations as simple and generic animations, which looked like a slide show done in Adobe Flash. Near the end they all got update and transformations looked extremely good with fluid and creative animations. They were in better position than Outers who didn't get any new Super henshins. But there was one thing, that was not done properly. Out of 3 Star Lights, Maker's 2nd version of transformation was never shown in full length. She never assumed her final pose. As she didn't get her own episode like Fighter or Healer. Her transformation is cut near the end, where she would strike her final pose. It is likely we will never again see it... And that's really sad.
=================================
BACKGROUND:
As for the background, I struggled a lot to come up with something nice and not too shitty and too simple. Firstly, I wanted to make an another color version of the background used for the Original Star Power Stick for Star Lights done by me, but then I realized that it wouldn't look too good and creative. Also, not very challenging and interesting enough, as opposed to the background used on the aforementioned deviation. So I decided to recreate backgrounds from the 2nd version of Sailor Star Maker's transformation, since that one seems to be the most interesting one and a lot more detailed tham BG from 1st version.
In order to create this background I edited the one used for Sailor Uranus' Lip Rod henshin item from "Uranus Planet Power, Make Up!", since it has the right amount of details and stars I wanted to use here. I changed the gradient colors from orange to blue, because that's the color used for Star Maker's transformation. I find it odd that they used this color for her transformation, since it doesn't match any of her image colors, but I decided to use it nonetheless, and surprisingly, it looks quite good Lots of stars added here and there really made the whole background really interesting and dynamic, and I like that a lot. I kind of fell in love with this background Oh My! I'm really sick
Also, during Star Lights' transformations (2nd version), 3 falling stars appear from the sky, surrounding Star Lights during their change. I decided to recreate that special effect I added the streams of light that moving stars leave behind them and added some star clusters that are also left behind the 3 falling stars (See: "Credits. With this the whole background looks dynamic and shiny, which was my aim from the beginning whatsoever ^^ But that was done to preserve the balance of the background And also to have the right amount of details. You know, I wanted to balance the chain with charms that comes out from the wand.
To summarize, as you can see, the BG consists of dark blue gradient, yellow shiny dot stars, small yellow and white stars and their smudges (see "Credits"), really big yellow 5-pointed stars with motion effects (done on my own) and following small yellow shiny stars, some black shadows in the background, some white circular mists, shine of the top star and yellow middle light flash. I must admit that I'm quite satisfied with this background and I may reuse it again with different color versions ^^ So far I think this backgrounds would be in my top favorites backgrounds I did so far
=================================
PHRASE TRANSLATION:
PL Gwiezdna Potęgo Twórcy, Działaj!
=================================
CREDITS:
Big and Small Star Brushes, Star Cluster Brushes (c) redheadstock - Thank you so much awesome user for sharing these brushes! They were very useful in creating this background which I'm proud of ^^ I really love all the brushes you made so far! They are beautiful and allow to make cool magical girls backgrounds! Thank you, thank you once again! Here is the credit for you redheadstock!
=================================
PERSONAL INFO:
Hello everyone! I'm returning from my Super Eternal Slumber Time! LOL And after almost 4 months(!!!)... here is the new picture! Still a recolor and re-edit of an old picture but I think it still count as something new, doesn't it!? xD For sure I have ideas for at least 3 more pictures And what is great, they will be for Star Lights, who need a lot of love from all the fans
And yes, I'm aware that in 2013, 2014 and at the beginning of 2015 I was horrible with new uploads. I should have posted more pictures in the last year, but I didn't have time to focus on making new pictures. School did its job perfectly distracting me from doing what I love to do! Having some free time, I decided to quickly finish one of my recent works (started in 2013, OMFG!!!) ^^ I really hope that you are not disappointed! Forgive me my bad behavior!!! T.T Gomenasai!
I recently have a break from making brooches and drawing things that are individual and only for one, max 3 Sailor Senshi, mostly leaders (because of the lack of free time). And that is also why I mostly do now re-edits and recolors of my older works, presenting them with new effects and new ideas. But I think it is worth it. Seeing old items refreshed and what not I will try to do more pictures now from time to time in my free time and finishing old projects started in 2013. LOL xD
My other recent works that I'm working on are making more staff forms of Sailor Moon rod (for example my manga version of Eternal Tiare which seem to be quite problematic), finishing the rest of the lockets from manga, mostly I want to do the opened form of Moon Crisis Compact and Crisis Chibi Moon's compact from the manga (in both - opened and closed forms), but it will of course have my special add-ons. Also, there are brooches from SeraMyu musicals! I still have not forgotten to make more of them! I will do more! Expect them to come!
And that's probably all I have to say for now!!! ^^ Have a great day everyone!
=================================
READ ME!!!
Do NOT copy, trace, edit or repost this artwork. I put a lot of effort into this picture and I don't want you to reuse elements of it, not to mention editing whole picture. Please, respect my will. I count on your fairness.
=================================
READ ME!!!
Do NOT copy, trace, edit or repost this artwork. I put a lot of effort into this picture and I don't want you to reuse elements of it, not to mention editing whole picture. Please, respect my will. I count on your fairness. Thanks!
=================================
EXPLANATION:
This is the Maker Star Power Stick transformation item (henshin wand) for Sailor Star Maker, or more precisely - Taiki Kou to become Star Sailor Senshi of the fifth season of the anime (Sailor Moon Sailor Stars) in the style of Inner Senshi from the second season of the 90s anime - Sailor Moon R. This is a what-if idea and fanmade item.
This is a what-if idea. THIS ITEM IS NOT THE OFFICIAL ITEM!!! NOR IS THE DESIGN!!! I have searched through dA and Google and I haven't found Star Power Sticks done for Star Lights. So I decided to make ones for them. But let's be honest here. Isn't it obvious that if Inner Senshi use "Star Power, Make Up!" incantation just like Star Lights, shouldn't Star Lights also have fan-created Star Power Sticks for them? LOL And here I am with my own idea Haha I hope you will enjoy it as much as I enjoyed making this item ^^
Some years ago I made Star Power Brooches and Sailor Star Yells for Solar System Senshi - a Star Light style items. And I immediately thought about making Star Power Sticks for Star Lights. The idea originated back in February 2013 and it was started back then. But I never got a push to actually make it come real. Now I had the inspiration to finally make it! And I want to continue ^^ So the future plans for Star Power Sticks of Star Lights are: making 2nd and 3rd version of Star Power Sticks for Star Lights in the unison form (similar for everyone; I have some nice ideas for them), making Sailor Kakyuu's version and 4 individual Star Power Sticks for each of Star Lights (Fighter, Healer, Maker and my OC - Lover). Please, stay tuned for them ^^
-----------------------------------------------------
Now it is time for Sailor Star Maker! Third individual Star Light style Star Power Stick! Yay! As you can see I have changed some colors here and there as compared to the version identical for everyone. The so called - Original Star Power Stick for Star Lights. Back in 2011 when I did Sailor Star Brooches for Star Lights in individual colors, I decided to give Star Lights 1st and 2nd colors.
For Star Maker I decided to use purple, because that's the color of her accessories in the 90s anime. I think this decision was quite obvious. It was not as problematic as main color for Star Fighter. What is more, purple for Star Maker appears as her as aura color during her attacks and in the background of second of her transformation (as well as the color of the galaxy in the final pose backgrounds). But blue seems to be more associated to her (like the BG in the 2nd version of her transformation). Which is quite odd as accessories for Fighter are in blue. As for the secondary color of Star Maker I decided to use creme yellow as this color is the color of Taiki's stage suit (quite problematic because details of the wand itself are golden, but I managed to keep the balance. At least I believe I did ) All in all, I like it ^^
For other Sailor Items please visit my gallery ^^
=================================
SOME INFO NOW ON THE ORIGINAL STAR LIGHTS' HENSHIN ITEMS:
In both manga and anime Star Lights transformed with two-pieced henshin item: Sailor Change Star - the head-set with microphone and Sailor Star Brooch - the winged chest brooch. They both formed Sailor Star Set. In order to transform Sailor Star Lights used their Brooches. In both versions they held it up and shouted their phrases.
In the anime, the transformation sequence also portrayed Change Star (an ear-wore microphone that appeared just when they phrase was being shouted). During the henshin Star Brooch was visible on the Senshi's chest and flashed during it. Star Brooch was likely the true transformation item of the Sailor Starlight's. The design of the Star Brooch and Change Star was similar for each of the Star Lights, but I did separate color versions of the Star Brooches for them. See links below for that ^^
=================================
SOME INFO NOW ON THE STAR POWER STICKS HENSHIN ITEMS:
In both manga and anime Star Power Sticks served as 2nd transformation items for Inner Senshi. They were given to them by Luna, replacing much weaker Transformation Pens. Star Power Sticks were the longest active transformation items in the Sailor Moon anime as they were used in most of Sailor Moon R, whole Sailor Moon S and half of Sailor Moon SuperS.
The Star Power Sticks were later replaced by (or more accurate - updated to) Crystal Change Rods by super powers of Pegasus in the 4th season of the anime. In the manga the final fate of Star Power Sticks is unknown as at the end of Black Moon Arc Neo-Queen Serenity gave Inner Senshi new powers - Planet Powers. And from that time on they were never shown again as Inner Senshi only needed to held up their hands in order to transform by invoking Planet Powers of their respective celestial bodies.
=================================
SEE ALSO:
<Name> Star Power, Make Up! - My Interpretation of Sailor Star Lights' Star Power Stick Henshin Item
The picture linked here is meant to show Star Power Stick for Star Lights in Original, identical form for each of them!
-----------------------------------------------------
Kinmoku Sailor Senshi Items - a folder in my gallery with items done for Kinmoku Sailor Senshi (Star Lights and Princess Kakyuu) as well as Star Light Style Items for Solar System Sailor Senshi. Please, visit and enjoy the pictures :-*
-----------------------------------------------------
<Name> Star Power, Make Up! - My Interpretation of Sailor Star Lights' Star Brooch Henshin Item
-----------------------------------------------------
ORIGINAL STAR LIGHTS' HENSHIN PHRASES (BROOCH FORMS):
Fighter Star Power, Make Up! - Sailor Star Fighter's Original Transformation Phrase (See Individual Color Version: fav.me/d39qqzu )
Healer Star Power, Make Up! - Sailor Star Healer's Original Transformation Phrase (See Individual Color Version: fav.me/d39qrfc )
Maker Star Power, Make Up! - Sailor Star Maker's Original Transformation Phrase (See Individual Color Version: fav.me/d39qrnf )
-----------------------------------------------------
ATTACK ITEM OF STAR LIGHTS:
Star <Adjective> <Noun>! - a Sailor Star Lights' attack with Sailor Star Yell from the 5th season of the Anime
=================================
DETAILS:
Before getting into details please notice that to make this wand I used lineart of "Mercury Star Power, Make Up!" and new shading effects from "Star Power of Ami and Friends", slightly modifying them to suit my taste and vision. I'm really sorry if that makes you upset, but that way I could make it easier. Beside, the first version of lineart was quite good. I had only few issues with shading. So that needed to be updated. The whole idea of this version of Star Power Stick was to make it similar to the ones owned by Inner Senshi, but distinguish different.
In order to better understand what I'm talking about, please visit this deviation here: karolhofman.deviantart.com/art… It shows the first version of Star Light style Star Power Stick identical for everyone.
-----------------------------------------------------
OK. Let's start with pointing out all the differences. From top to bottom. The top star has extra shading added now to make it look more 3d and more in the style of my recent works Continuing. The middle of the top star on Inner Senshi's Star Power Sticks is a circular plate which showcases planetary symbol for each of them. Since Star Lights don't have planetary symbols I decided to put there some kind of crystal. Firstly, I wanted it to be star-shaped, but then I scrapped that idea as there would be too many stars. So I placed there circular crystal from Sailor Star Yell - attack item of Star Lights. Originally it is orange, but for Star Maker's version I colored it in purple - Maker's main color.
The four pearls around said crystal have now circular rims (because when you zoom in, for example, Mercury's Star Power Stick, you will notice them). They are colored in the same color as on the original Star Power Sticks. But the pearls themselves for "Original" Star Lights' Star Power Sticks were colored in yellow/golden. For Star Maker they are in creme yellow - the secondary color for Star Maker (reminder: originally they are golden). I know that the original color and Maker's creme yellow are too similar, but I guess it still looks quite nice, eh? Moving down, the crown-like thing under star was colored in creme yellow as well (originally light blue).
On both sides of the crown-like thing, there are wings. They are the same as ones from Sailor Star Yell, but modified slightly to fit with the overall design of the stick. I had to add somewhere wings, and this was the best place to do so. All the items of Star Lights from anime and manga have wings: Star Power Brooch, Star Power Headset and Sailor Star Yell. So their versions of Star Power Sticks also need to include them. OK. Moving down on the stick, we have the handle of the wand. It was colored in Maker's purple. Originally it is navy blue - the same color as Sailor Star Lights' leather outfits. I like in the end how it turned out ^^
Bottom part was colored in orange-like golden (the same color as the main part of the crown-like thingy) and creme yellow (originally sand-like golden - the same color as the top star). The last touch was adding a chain to the wand. I felt like something is lacking here. And I remembered that Star Power Brooch of Star Lights has a chain, so I added it here too. Two stripes of them. But again, something was lacking so I added star-like charms at the end. And that was my final touch to this Star Power Stick. I think that all these changes make it similar to the Inner Senshi's ones, but still having the spirit of Star Lights in it. I love how it turned out! Yay!
And that's probably all I had to say here ^^
=================================
IMPORTANT VIDEO TO BE SEEN!!! xD
Star Lights Transformation Theme - Please listen to this Transformation Theme of Star Lights to better understand the meaning of this picture and feel the power of Three Lights!!!
=================================
FUN FACTS - TRIIVIA:
Did you know that Star Lights had 2 versions of their transformations? Most of Sailor Moon Sailor Stars season had their transformations as simple and generic animations, which looked like a slide show done in Adobe Flash. Near the end they all got update and transformations looked extremely good with fluid and creative animations. They were in better position than Outers who didn't get any new Super henshins. But there was one thing, that was not done properly. Out of 3 Star Lights, Maker's 2nd version of transformation was never shown in full length. She never assumed her final pose. As she didn't get her own episode like Fighter or Healer. Her transformation is cut near the end, where she would strike her final pose. It is likely we will never again see it... And that's really sad.
=================================
BACKGROUND:
As for the background, I struggled a lot to come up with something nice and not too shitty and too simple. Firstly, I wanted to make an another color version of the background used for the Original Star Power Stick for Star Lights done by me, but then I realized that it wouldn't look too good and creative. Also, not very challenging and interesting enough, as opposed to the background used on the aforementioned deviation. So I decided to recreate backgrounds from the 2nd version of Sailor Star Maker's transformation, since that one seems to be the most interesting one and a lot more detailed tham BG from 1st version.
In order to create this background I edited the one used for Sailor Uranus' Lip Rod henshin item from "Uranus Planet Power, Make Up!", since it has the right amount of details and stars I wanted to use here. I changed the gradient colors from orange to blue, because that's the color used for Star Maker's transformation. I find it odd that they used this color for her transformation, since it doesn't match any of her image colors, but I decided to use it nonetheless, and surprisingly, it looks quite good Lots of stars added here and there really made the whole background really interesting and dynamic, and I like that a lot. I kind of fell in love with this background Oh My! I'm really sick
Also, during Star Lights' transformations (2nd version), 3 falling stars appear from the sky, surrounding Star Lights during their change. I decided to recreate that special effect I added the streams of light that moving stars leave behind them and added some star clusters that are also left behind the 3 falling stars (See: "Credits. With this the whole background looks dynamic and shiny, which was my aim from the beginning whatsoever ^^ But that was done to preserve the balance of the background And also to have the right amount of details. You know, I wanted to balance the chain with charms that comes out from the wand.
To summarize, as you can see, the BG consists of dark blue gradient, yellow shiny dot stars, small yellow and white stars and their smudges (see "Credits"), really big yellow 5-pointed stars with motion effects (done on my own) and following small yellow shiny stars, some black shadows in the background, some white circular mists, shine of the top star and yellow middle light flash. I must admit that I'm quite satisfied with this background and I may reuse it again with different color versions ^^ So far I think this backgrounds would be in my top favorites backgrounds I did so far
=================================
PHRASE TRANSLATION:
PL Gwiezdna Potęgo Twórcy, Działaj!
=================================
CREDITS:
Big and Small Star Brushes, Star Cluster Brushes (c) redheadstock - Thank you so much awesome user for sharing these brushes! They were very useful in creating this background which I'm proud of ^^ I really love all the brushes you made so far! They are beautiful and allow to make cool magical girls backgrounds! Thank you, thank you once again! Here is the credit for you redheadstock!
=================================
PERSONAL INFO:
Hello everyone! I'm returning from my Super Eternal Slumber Time! LOL And after almost 4 months(!!!)... here is the new picture! Still a recolor and re-edit of an old picture but I think it still count as something new, doesn't it!? xD For sure I have ideas for at least 3 more pictures And what is great, they will be for Star Lights, who need a lot of love from all the fans
And yes, I'm aware that in 2013, 2014 and at the beginning of 2015 I was horrible with new uploads. I should have posted more pictures in the last year, but I didn't have time to focus on making new pictures. School did its job perfectly distracting me from doing what I love to do! Having some free time, I decided to quickly finish one of my recent works (started in 2013, OMFG!!!) ^^ I really hope that you are not disappointed! Forgive me my bad behavior!!! T.T Gomenasai!
I recently have a break from making brooches and drawing things that are individual and only for one, max 3 Sailor Senshi, mostly leaders (because of the lack of free time). And that is also why I mostly do now re-edits and recolors of my older works, presenting them with new effects and new ideas. But I think it is worth it. Seeing old items refreshed and what not I will try to do more pictures now from time to time in my free time and finishing old projects started in 2013. LOL xD
My other recent works that I'm working on are making more staff forms of Sailor Moon rod (for example my manga version of Eternal Tiare which seem to be quite problematic), finishing the rest of the lockets from manga, mostly I want to do the opened form of Moon Crisis Compact and Crisis Chibi Moon's compact from the manga (in both - opened and closed forms), but it will of course have my special add-ons. Also, there are brooches from SeraMyu musicals! I still have not forgotten to make more of them! I will do more! Expect them to come!
And that's probably all I have to say for now!!! ^^ Have a great day everyone!
=================================
READ ME!!!
Do NOT copy, trace, edit or repost this artwork. I put a lot of effort into this picture and I don't want you to reuse elements of it, not to mention editing whole picture. Please, respect my will. I count on your fairness.
Image size
800x600px 452.29 KB
© 2015 - 2024 KarolHofman
Comments29
Join the community to add your comment. Already a deviant? Log In
Nice